PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P03250_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Nin-like
Protein Properties Length: 613aa    MW: 67809.5 Da    PI: 7.3785
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P03250_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.5e-29302353152
                 RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                            aek+isle+l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  GSMUA_Achr3P03250_001 302 AEKTISLEVLQQYFCGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 353
                            589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-4288343IPR009057Homeodomain-like
PROSITE profilePS5151917.632292373IPR003035RWP-RK domain
PfamPF020423.0E-26305353IPR003035RWP-RK domain
SMARTSM006667.2E-21517599IPR000270PB1 domain
SuperFamilySSF542774.25E-19517602No hitNo description
PfamPF005642.1E-16517598IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-23517598No hitNo description
PROSITE profilePS5174521.254517599IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MTSQKVNYAG EVDKVCKALE AVNLKSFEIM KNPSVQICNE GRQAALAEIL QTIAMVCEKY  60
KLPLAQTWVP CRHRTILADG GGSKKSCSSF DGSCMGQVCM STTDVAFHVI DAHLWGFREA  120
CVEHHLQKGQ GVAGMSFALR RPCFSKDITK FCKIEYPLVH YARMFKLRSC FAICLQSSYT  180
GNDDYLLEFF LPLECKTFGE QQALLKSMIS LMTKCFHSLR PSIDVEPQEG KAFDLDVFAI  240
EYQELEPKFI NIVSYEGRHS ESSEIKSNEG LDDPVHEENK VPEISEEHLT KNKPLEKRRG  300
KAEKTISLEV LQQYFCGSLK DAAKSLGVCP TTMKRICRQH GISRWPSRKI NKVNRSLSKL  360
KQVIESVQGA DSAFNLTTLT GSLPVETSMR GPSYTEYPST GLRESVDSHS NIQLEPGKDI  420
PSSKSRSSSG QGSTSTPASE GSCHGSPIND THECNQIVSS NLEAGTKPSL DATKPCARVP  480
NAFVLCSTSD AILMEPQATI DVAPVPAKPV QMQDLVTVTI KASYKGNIIR FRLPSTAGVV  540
ILKNEISKRL KMDVSMFDIK YMDDDREWVT LSCTADLEEC IELSRQSGGN PIRLLVSDLH  600
SNFGSSCESS RGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390721.10.0PREDICTED: protein NLP3-like
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLM0SBE30.0M0SBE3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P03250_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein